General Information

  • ID:  hor001200
  • Uniprot ID:  G5EBV5
  • Protein name:  FLP-12
  • Gene name:  flp-12
  • Organism:  Caenorhabditis elegans
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0061096 negative regulation of turning behavior involved in mating
  • GO CC:  NA

Sequence Information

  • Sequence:  RNKFEFIRF
  • Length:  9
  • Propeptide:  MNVQVIIALLFCLIATCATQKVKGSPEVLPAAMYDGELSHESVNKISAQLLNALSELEALQEGNQQLKMAEKRRNKFEFIRFGRK
  • Signal peptide:  MNVQVIIALLFCLIATCAT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G5EBV5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001200_AF2.pdbhor001200_ESM.pdb

Physical Information

Mass: 139933 Formula: C60H89N17O13
Absent amino acids: ACDGHLMPQSTVWY Common amino acids: F
pI: 11.48 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -77.78 Boman Index: -3498
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 4891.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans